AMH antibody (Middle Region)

Catalog No. ABIN634797

This anti-AMH antibody is a Rabbit Polyclonal antibody detecting AMH in WB. Suitable for Human, Mouse and Rat.

Quick Overview for AMH antibody (Middle Region) (ABIN634797)

Target: AMH (Anti-Mullerian Hormone (AMH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AMH Antibody

Binding Specificity: Middle Region

Specificity: AMH antibody was raised against the middle region of AMH

Purification: Affinity purified

Immunogen: AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMH Blocking Peptide, (ABIN5612045), is also available for use as a blocking control in assays to test for specificity of this AMH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMH

Target: AMH (Anti-Mullerian Hormone (AMH))

Alternative Name: AMH

Background: Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion