AMH antibody (Middle Region)
-
- Target See all AMH Antibodies
- AMH (Anti-Mullerian Hormone (AMH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AMH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AMH antibody was raised against the middle region of AMH
- Purification
- Affinity purified
- Immunogen
- AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
- Top Product
- Discover our top product AMH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AMH Blocking Peptide, catalog no. 33R-8906, is also available for use as a blocking control in assays to test for specificity of this AMH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AMH (Anti-Mullerian Hormone (AMH))
- Alternative Name
- AMH (AMH Products)
- Synonyms
- AMH antibody, amh antibody, MIF antibody, MIS antibody, anti-Mullerian hormone antibody, amh antibody, AMH antibody, Amh antibody
- Background
- Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-