Enkephalin antibody (Middle Region)

Catalog No. ABIN634799

The Rabbit Polyclonal anti-Enkephalin antibody has been validated for WB. It is suitable to detect Enkephalin in samples from Human.

Quick Overview for Enkephalin antibody (Middle Region) (ABIN634799)

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Enkephalin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Enkephalin Antibody

Binding Specificity: Middle Region

Specificity: PENK antibody was raised against the middle region of PENK

Purification: Affinity purified

Immunogen: PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PENK Blocking Peptide, (ABIN937232), is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Enkephalin

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Alternative Name: PENK

Background: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Stem Cell Maintenance