IL-4 antibody (Middle Region)

Catalog No. ABIN634804

Product Details anti-IL-4 Antibody

Target: IL-4 (IL4) (Interleukin 4 (IL4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL4 antibody was raised against the middle region of IL4

Purification: Affinity purified

Immunogen: IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL4 Blocking Peptide, catalog no. 33R-9363, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-4

Target: IL-4 (IL4) (Interleukin 4 (IL4))

Alternative Name: IL4 (IL4 Products)

Synonyms: IL4 antibody, IL-4 antibody, BCGF-1 antibody, BCGF1 antibody, BSF-1 antibody, BSF1 antibody, Il-4 antibody, Il4e12 antibody, IL2 antibody, interleukin 4 antibody, IL4 antibody, Il4 antibody

Background: IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation