IL-4 antibody (Middle Region)
-
- Target See all IL-4 (IL4) Antibodies
- IL-4 (IL4) (Interleukin 4 (IL4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL-4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL4 antibody was raised against the middle region of IL4
- Purification
- Affinity purified
- Immunogen
- IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
- Top Product
- Discover our top product IL4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL4 Blocking Peptide, catalog no. 33R-9363, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-4 (IL4) (Interleukin 4 (IL4))
- Alternative Name
- IL4 (IL4 Products)
- Synonyms
- IL4 antibody, IL-4 antibody, BCGF-1 antibody, BCGF1 antibody, BSF-1 antibody, BSF1 antibody, Il-4 antibody, Il4e12 antibody, IL2 antibody, interleukin 4 antibody, IL4 antibody, Il4 antibody
- Background
- IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.
- Molecular Weight
- 15 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation
-