Hepcidin antibody (Hepcidin Antimicrobial Peptide) (N-Term)

Details for Product anti-HAMP Antibody No. ABIN634809
Antigen
Epitope
N-Term
17
10
9
8
7
7
6
5
5
2
2
2
2
1
1
1
1
Reactivity
Human
86
32
11
4
3
2
1
Host
Rabbit
91
15
8
Clonality
Polyclonal
Conjugate
This Hepcidin antibody is un-conjugated
13
9
3
3
3
3
2
2
2
2
2
2
Application
Western Blotting (WB)
90
61
35
12
9
8
6
5
4
3
2
2
1
1
1
Options
Immunogen HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Specificity HAMP antibody was raised against the N terminal of HAMP
Purification Affinity purified
Antigen
Alternative Name HAMP (HAMP Antibody Abstract)
Background The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.
Molecular Weight 9 kDa (MW of target protein)
Pathways Hormone Activity, Transition Metal Ion Homeostasis
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Hepcidin Antimicrobial Peptide (HAMP) (N-Term) antibody (ABIN634809) HAMP antibody used at 1 ug/ml to detect target protein.