Neuregulin 3 antibody (Middle Region)

Catalog No. ABIN634810

This Rabbit Polyclonal antibody specifically detects Neuregulin 3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Neuregulin 3 antibody (Middle Region) (ABIN634810)

Target: Neuregulin 3 (NRG3)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuregulin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Neuregulin 3 Antibody

Binding Specificity: Middle Region

Specificity: NRG3 antibody was raised against the middle region of NRG3

Purification: Affinity purified

Immunogen: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRG3 Blocking Peptide, (ABIN5615063), is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuregulin 3

Target: Neuregulin 3 (NRG3)

Alternative Name: NRG3

Background: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Molecular Weight: 75 kDa (MW of target protein)

Pathways: RTK Signaling