Peptide YY antibody (Middle Region)

Catalog No. ABIN634817

The Rabbit Polyclonal anti-Peptide YY antibody has been validated for WB. It is suitable to detect Peptide YY in samples from Human, Mouse, Rat and Dog.

Quick Overview for Peptide YY antibody (Middle Region) (ABIN634817)

Target: Peptide YY (PYY)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peptide YY antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Peptide YY Antibody

Binding Specificity: Middle Region

Specificity: PYY antibody was raised against the middle region of PYY

Purification: Affinity purified

Immunogen: PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYY Blocking Peptide, (ABIN936822), is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peptide YY

Target: Peptide YY (PYY)

Alternative Name: PYY

Background: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Molecular Weight: 11 kDa (MW of target protein)