ABCC9 antibody
-
- Target See all ABCC9 Antibodies
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCC9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
- Top Product
- Discover our top product ABCC9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Alternative Name
- ABCC9 (ABCC9 Products)
- Synonyms
- SUR2B antibody, DDBDRAFT_0215814 antibody, DDBDRAFT_0216237 antibody, DDB_0215814 antibody, DDB_0216237 antibody, si:dkey-183c2.3 antibody, sur2 antibody, ABC37 antibody, ATFB12 antibody, CANTU antibody, CMD1O antibody, SUR2 antibody, SUR2A antibody, AI414027 antibody, AI449286 antibody, Sur2 antibody, ABCC9 antibody, ATP binding cassette subfamily C member 9 antibody, ATP-binding cassette sub-family C member 8 antibody, ABC transporter C family protein antibody, ATP-binding cassette sub-family C member 9 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 9 antibody, ABCC9 antibody, LOC581821 antibody, abcC9 antibody, LOC100470981 antibody, abcc9 antibody, Abcc9 antibody
- Background
- ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.
- Molecular Weight
- 174 kDa (MW of target protein)
-