FMO4 antibody (N-Term)

Catalog No. ABIN634825

Product Details anti-FMO4 Antibody

Target: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FMO4 antibody was raised against the N terminal of FMO4

Purification: Affinity purified

Immunogen: FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FMO4

Target: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Alternative Name: FMO4 (FMO4 Products)

Synonyms: FMO2 antibody, D1Ertd532e antibody, flavin containing monooxygenase 4 antibody, FMO4 antibody, Fmo4 antibody

Background: FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.

Molecular Weight: 63 kDa (MW of target protein)