SLC39A7 antibody

Catalog No. ABIN634829

Product Details anti-SLC39A7 Antibody

Target: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC39A7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC39 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A7 Blocking Peptide, catalog no. 33R-3709, is also available for use as a blocking control in assays to test for specificity of this SLC39A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC39A7

Target: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Alternative Name: SLC39A7 (SLC39A7 Products)

Synonyms: ke4 antibody, HKE4 antibody, id:ibd5081 antibody, wu:fc28c09 antibody, hke4 antibody, zip7 antibody, ring5 antibody, h2-ke4 antibody, d6s115e antibody, d6s2244e antibody, D6S115E antibody, D6S2244E antibody, H2-KE4 antibody, KE4 antibody, RING5 antibody, ZIP7 antibody, AA408174 antibody, AI117660 antibody, AL024048 antibody, H-2Ke4 antibody, H2-Ke4 antibody, Ke-4 antibody, Ke4 antibody, Ring5 antibody, Zip7 antibody, RT1-Ke4 antibody, Rt1Ke4 antibody, solute carrier family 39 (zinc transporter), member 7 antibody, solute carrier family 39 member 7 antibody, solute carrier family 39 member 7 L homeolog antibody, zinc transporter protein ZIP7 antibody, slc39a7 antibody, SLC39A7 antibody, slc39a7.L antibody, Slc39a7 antibody, zip7 antibody

Background: Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis