ABCE1 antibody

Catalog No. ABIN634841

Product Details anti-ABCE1 Antibody

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCE1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCE1 Blocking Peptide, catalog no. 33R-4770, is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCE1

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Alternative Name: ABCE1 (ABCE1 Products)

Synonyms: ABCE1 antibody, DDBDRAFT_0188931 antibody, DDBDRAFT_0191227 antibody, DDB_0188931 antibody, DDB_0191227 antibody, abce1 antibody, MGC69546 antibody, DKFZp469K1416 antibody, ABC38 antibody, OABP antibody, RLI antibody, RNASEL1 antibody, RNASELI antibody, RNS4I antibody, C79080 antibody, Oabp antibody, RNS41 antibody, Rnaseli antibody, wu:fb34c09 antibody, wu:fe47b01 antibody, wu:fi09g07 antibody, zgc:111906 antibody, zgc:56045 antibody, Rns4i antibody, ATP binding cassette subfamily E member 1 antibody, 4Fe-4S ferredoxin, iron-sulfur binding domain-containing protein antibody, ATP-binding cassette sub-family E member 1 antibody, RNAse L inhibitor antibody, RNase L inhibitor antibody, ribosome biogenesis/translation initiation ATPase RLI antibody, ATP-binding cassette, sub-family E (OABP), member 1 antibody, ATP binding cassette subfamily E member 1 S homeolog antibody, ABCE1 antibody, abcE1 antibody, LOC100184673 antibody, LOC100213121 antibody, abce1 antibody, TP04_0855 antibody, PVX_115370 antibody, TERMP_RS03360 antibody, Abce1 antibody, abce1.S antibody

Background: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.

Molecular Weight: 67 kDa (MW of target protein)