STEAP3 antibody (C-Term)
-
- Target See all STEAP3 Antibodies
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STEAP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- STEAP3 antibody was raised against the C terminal of STEAP3
- Purification
- Affinity purified
- Immunogen
- STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
- Top Product
- Discover our top product STEAP3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STEAP3 Blocking Peptide, catalog no. 33R-9427, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
- Alternative Name
- STEAP3 (STEAP3 Products)
- Background
- AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-