SLC37A4 antibody
-
- Target See all SLC37A4 Antibodies
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC37A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
- Top Product
- Discover our top product SLC37A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC37A4 Blocking Peptide, catalog no. 33R-9804, is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))
- Alternative Name
- SLC37A4 (SLC37A4 Products)
- Synonyms
- G6PT1 antibody, G6PT2 antibody, G6PT3 antibody, GSD1b antibody, GSD1c antibody, GSD1d antibody, TRG-19 antibody, TRG19 antibody, G6PC antibody, G6PT antibody, G6pt1 antibody, GSD-1b antibody, mG6PT antibody, MGC68695 antibody, g6pt1 antibody, g6pt2 antibody, g6pt3 antibody, gsd1b antibody, gsd1c antibody, gsd1d antibody, trg19 antibody, pro0685 antibody, MGC97640 antibody, slc37a4 antibody, wu:fc25d06 antibody, zgc:77098 antibody, solute carrier family 37 member 4 antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4 antibody, solute carrier family 37 member 4 L homeolog antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4a antibody, SLC37A4 antibody, Slc37a4 antibody, slc37a4.L antibody, slc37a4 antibody, slc37a4a antibody
- Background
- SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
-