DNASE1 antibody (N-Term)

Catalog No. ABIN634872

Product Details anti-DNASE1 Antibody

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNASE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DNASE1 antibody was raised against the N terminal of DNASE1

Purification: Affinity purified

Immunogen: DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNASE1 Blocking Peptide, catalog no. 33R-3371, is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNASE1

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Alternative Name: DNASE1 (DNASE1 Products)

Synonyms: LOC397802 antibody, DNL1 antibody, DRNI antibody, AI788650 antibody, DNaseI antibody, Dnl1 antibody, dnase1-A antibody, zgc:92440 antibody, DNase I antibody, deoxyribonuclease 1 antibody, deoxyribonuclease I antibody, deoxyribonuclease I L homeolog antibody, Deoxyribonuclease I antibody, endA antibody, LOC397802 antibody, DNASE1 antibody, Dnase1 antibody, dnase1.L antibody, dnase1 antibody, CpipJ_CPIJ011184 antibody, CpipJ_CPIJ011185 antibody, CpipJ_CPIJ011186 antibody, CpipJ_CPIJ011187 antibody, CpipJ_CPIJ011190 antibody, CpipJ_CPIJ017803 antibody, Desal_1409 antibody, MPET_RS05255 antibody, METEV_RS02275 antibody, Plabr_0631 antibody

Background: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

Molecular Weight: 29 kDa (MW of target protein)