SEC22C antibody

Catalog No. ABIN634875

This anti-SEC22C antibody is a Rabbit Polyclonal antibody detecting SEC22C in WB. Suitable for Human.

Quick Overview for SEC22C antibody (ABIN634875)

Target: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEC22C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SEC22C Antibody

Purification: Affinity purified

Immunogen: SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEC22C Blocking Peptide, (ABIN938439), is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEC22C

Target: SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))

Alternative Name: SEC22C

Background: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.

Molecular Weight: 34 kDa (MW of target protein)