ACMSD antibody (Middle Region)

Catalog No. ABIN634884

Product Details anti-ACMSD Antibody

Target: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACMSD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACMSD antibody was raised against the middle region of ACMSD

Purification: Affinity purified

Immunogen: ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACMSD Blocking Peptide, catalog no. 33R-6822, is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACMSD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACMSD

Target: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Alternative Name: ACMSD (ACMSD Products)

Synonyms: zgc:162888 antibody, ACMSD antibody, aminocarboxymuconate semialdehyde decarboxylase antibody, aminocarboxymuconate semialdehyde decarboxylase S homeolog antibody, amino carboxymuconate semialdehyde decarboxylase antibody, ACMSD antibody, acmsd antibody, acmsd.S antibody, Acmsd antibody

Background: The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.

Molecular Weight: 38 kDa (MW of target protein)