LFNG antibody (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase) (N-Term)

Details for Product anti-LFNG Antibody No. ABIN634905
Antigen
Epitope
N-Term
14
12
10
9
8
4
2
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
63
13
11
2
1
1
1
1
1
1
Host
Rabbit
48
15
Clonality
Polyclonal
Conjugate
This LFNG antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
53
40
25
21
5
4
1
1
Options
Immunogen LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK
Specificity LFNG antibody was raised against the N terminal of LFNG
Purification Affinity purified
Antigen
Alternative Name LFNG (LFNG Antibody Abstract)
Background LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.
Molecular Weight 39 kDa (MW of target protein)
Pathways Notch Signaling
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG) (N-Term) antibody (ABIN634905) LFNG antibody used at 1 ug/ml to detect target protein.