DNAJC25 antibody

Catalog No. ABIN634906

Product Details anti-DNAJC25 Antibody

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC25 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC25

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Alternative Name: DNAJC25 (DNAJC25 Products)

Synonyms: bA16L21.2.1 antibody, ERJ7 antibody, GNG10 antibody, dnj2 antibody, dnajc25 antibody, 2010109C08Rik antibody, 2010203O07Rik antibody, Dnajc25 antibody, DnaJ heat shock protein family (Hsp40) member C25 antibody, DnaJ heat shock protein family (Hsp40) member C25 S homeolog antibody, DnaJ (Hsp40) homolog, subfamily C , member 25 antibody, dnaJ homolog subfamily C member 25 antibody, DNAJC25 antibody, dnajc25 antibody, dnajc25.S antibody, Dnajc25 antibody, LOC100730599 antibody

Background: DNAJC25 may be involved in heat shock protein binding.

Molecular Weight: 42 kDa (MW of target protein)