Tricellulin antibody (Middle Region)

Catalog No. ABIN634907

The Rabbit Polyclonal anti-Tricellulin antibody is suitable to detect Tricellulin in samples from Human and Mouse. It has been validated for WB.

Quick Overview for Tricellulin antibody (Middle Region) (ABIN634907)

Target: Tricellulin (MARVELD2)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tricellulin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tricellulin Antibody

Binding Specificity: Middle Region

Specificity: MARVELD2 antibody was raised against the middle region of MARVELD2

Purification: Affinity purified

Immunogen: MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARVELD2 Blocking Peptide, (ABIN5614673), is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tricellulin

Target: Tricellulin (MARVELD2)

Alternative Name: MARVELD2

Background: Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization