HRK antibody
-
- Target See all HRK Antibodies
- HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HRK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
- Top Product
- Discover our top product HRK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HRK Blocking Peptide, catalog no. 33R-5817, is also available for use as a blocking control in assays to test for specificity of this HRK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))
- Alternative Name
- HRK (HRK Products)
- Synonyms
- DP5 antibody, HARAKIRI antibody, AI838259 antibody, Bid3 antibody, harakiri antibody, Dp5 antibody, harakiri, BCL2 interacting protein antibody, harakiri, BCL2 interacting protein (contains only BH3 domain) antibody, HRK antibody, Hrk antibody
- Background
- Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members.
- Molecular Weight
- 10 kDa (MW of target protein)
-