Patched 1 antibody
-
- Target See all Patched 1 (PTCH1) Antibodies
- Patched 1 (PTCH1)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Patched 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
- Top Product
- Discover our top product PTCH1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTCH1 Blocking Peptide, catalog no. 33R-9121, is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Patched 1 (PTCH1)
- Alternative Name
- PTCH1 (PTCH1 Products)
- Background
- PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling, Carbohydrate Homeostasis, Tube Formation
-