MMP23B antibody (N-Term)

Catalog No. ABIN634931

Product Details anti-MMP23B Antibody

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP23B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MMP23 B antibody was raised against the N terminal of MMP23

Purification: Affinity purified

Immunogen: MMP23 B antibody was raised using the N terminal of MMP23 corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP23B Blocking Peptide, catalog no. 33R-4060, is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP23B

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Alternative Name: MMP23B (MMP23B Products)

Synonyms: MIFR antibody, MIFR-1 antibody, MMP22 antibody, MMP23A antibody, MMP23 antibody, mmp23al antibody, mmp23b antibody, zgc:110623 antibody, MMP23B antibody, matrix metallopeptidase 23B antibody, matrix metallopeptidase 23bb antibody, MMP23B antibody, mmp23bb antibody, Mmp23b antibody

Background: MMP23B is a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.

Molecular Weight: 36 kDa (MW of target protein)