Derlin-3 antibody (C-Term)

Catalog No. ABIN634939

This Rabbit Polyclonal antibody specifically detects Derlin-3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Derlin-3 antibody (C-Term) (ABIN634939)

Target: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Derlin-3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Derlin-3 Antibody

Binding Specificity: C-Term

Specificity: DERL3 antibody was raised against the C terminal of DERL3

Purification: Affinity purified

Immunogen: DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DERL3 Blocking Peptide, (ABIN936276), is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Derlin-3

Target: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Alternative Name: DERL3

Background: DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling