MFF antibody (C-Term)

Catalog No. ABIN634945

Product Details anti-MFF Antibody

Target: MFF (Mitochondrial Fission Factor (MFF))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C2 ORF33 antibody was raised against the C terminal Of C2 rf33

Purification: Affinity purified

Immunogen: C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2ORF33 Blocking Peptide, catalog no. 33R-9870, is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFF

Target: MFF (Mitochondrial Fission Factor (MFF))

Alternative Name: C2ORF33 (MFF Products)

Synonyms: zgc:66022 antibody, mff antibody, gl004 antibody, MGC79121 antibody, MGC80099 antibody, C2orf33 antibody, GL004 antibody, C2H2orf33 antibody, 5230400G24Rik antibody, AI314724 antibody, RGD1310230 antibody, mitochondrial fission factor antibody, mitochondrial fission factor L homeolog antibody, mitochondrial fission factor S homeolog antibody, mff antibody, mff.L antibody, mff.S antibody, MFF antibody, Mff antibody

Background: C2orf33 plays a role in mitochondrial and peroxisomal fission.

Molecular Weight: 38 kDa (MW of target protein)