IL22 Receptor alpha 1 antibody (Middle Region)

Catalog No. ABIN634946

The Rabbit Polyclonal anti-IL22 Receptor alpha 1 antibody has been validated for WB. It is suitable to detect IL22 Receptor alpha 1 in samples from Human and Mouse.

Quick Overview for IL22 Receptor alpha 1 antibody (Middle Region) (ABIN634946)

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL22 Receptor alpha 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL22 Receptor alpha 1 Antibody

Binding Specificity: Middle Region

Specificity: IL22 R alpha 1 antibody was raised against the middle region of IL22 A1

Purification: Affinity purified

Immunogen: IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL22R alpha 1 Blocking Peptide, (ABIN936210), is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL22 Receptor alpha 1

Target: IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))

Alternative Name: IL22R alpha 1

Background: IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).

Molecular Weight: 63 kDa (MW of target protein)