Thymopoietin antibody (N-Term)
-
- Target See all Thymopoietin (TMPO) Antibodies
- Thymopoietin (TMPO)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Thymopoietin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Thymopoietin antibody was raised against the N terminal of TMPO
- Purification
- Affinity purified
- Immunogen
- Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP
- Top Product
- Discover our top product TMPO Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Thymopoietin Blocking Peptide, catalog no. 33R-7041, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Thymopoietin (TMPO)
- Alternative Name
- Thymopoietin (TMPO Products)
- Synonyms
- LAP2 antibody, CMD1T antibody, LEMD4 antibody, PRO0868 antibody, TP antibody, lap2 antibody, LAP2beta antibody, 5630400D24Rik antibody, AI195756 antibody, AI606875 antibody, AW214352 antibody, AW547477 antibody, tmpo antibody, wu:fc26f12 antibody, wu:fd21f02 antibody, wu:fi29h05 antibody, thymopoietin antibody, thymopoietin S homeolog antibody, thymopoietin a antibody, TMPO antibody, Tmpo antibody, tmpo.S antibody, tmpoa antibody
- Background
- TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
- Molecular Weight
- 39 kDa (MW of target protein)
-