PARL antibody (N-Term)

Catalog No. ABIN634971

This anti-PARL antibody is a Rabbit Polyclonal antibody detecting PARL in WB and IHC. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for PARL antibody (N-Term) (ABIN634971)

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PARL Antibody

Binding Specificity: N-Term

Specificity: PARL antibody was raised against the N terminal of PARL

Purification: Affinity purified

Immunogen: PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARL Blocking Peptide, (ABIN5615220), is also available for use as a blocking control in assays to test for specificity of this PARL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARL

Target: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Alternative Name: PARL

Background: PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Autophagy