PARL antibody (N-Term)
-
- Target See all PARL Antibodies
- PARL (Presenilin Associated, Rhomboid-Like (PARL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARL antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PARL antibody was raised against the N terminal of PARL
- Purification
- Affinity purified
- Immunogen
- PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
- Top Product
- Discover our top product PARL Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARL Blocking Peptide, catalog no. 33R-8594, is also available for use as a blocking control in assays to test for specificity of this PARL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARL (Presenilin Associated, Rhomboid-Like (PARL))
- Alternative Name
- PARL (PARL Products)
- Synonyms
- PSARL antibody, PSARL1 antibody, PSENIP2 antibody, RHBDS1 antibody, D16Ertd607e antibody, PRO2207 antibody, Psarl antibody, parl antibody, zgc:112986 antibody, presenilin associated rhomboid like antibody, presenilin associated, rhomboid-like antibody, presenilin associated, rhomboid-like a antibody, PARL antibody, Parl antibody, parla antibody
- Background
- PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Autophagy
-