NDUFB5 antibody

Catalog No. ABIN634974

The Rabbit Polyclonal anti-NDUFB5 antibody (ABIN634974) specifically detects NDUFB5 in WB. The antibody is reactive with Human samples.

Quick Overview for NDUFB5 antibody (ABIN634974)

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFB5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDUFB5 Antibody

Purification: Affinity purified

Immunogen: NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFB5 Blocking Peptide, (ABIN939907), is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFB5

Target: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Alternative Name: NDUFB5

Background: NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molecular Weight: 17 kDa (MW of target protein)