ATG9A antibody
-
- Target See all ATG9A Antibodies
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATG9A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
- Top Product
- Discover our top product ATG9A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
- Alternative Name
- ATG9A (ATG9A Products)
- Background
- ATG9A belongs to the ATG9 family. It plays a role in autophagy.
- Molecular Weight
- 94 kDa (MW of target protein)
-