ATG9A antibody

Catalog No. ABIN634988

The Rabbit Polyclonal anti-ATG9A antibody is suitable to detect ATG9A in samples from Human. It has been validated for WB.

Quick Overview for ATG9A antibody (ABIN634988)

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATG9A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATG9A Antibody

Purification: Affinity purified

Immunogen: ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATG9A Blocking Peptide, (ABIN5612211), is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATG9A

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Alternative Name: ATG9A

Background: ATG9A belongs to the ATG9 family. It plays a role in autophagy.

Molecular Weight: 94 kDa (MW of target protein)