CEACAM16 antibody (Middle Region)

Catalog No. ABIN635003

The Rabbit Polyclonal anti-CEACAM16 antibody has been validated for WB. It is suitable to detect CEACAM16 in samples from Human, Mouse and Rat.

Quick Overview for CEACAM16 antibody (Middle Region) (ABIN635003)

Target: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEACAM16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CEACAM16 Antibody

Binding Specificity: Middle Region

Specificity: CEACAM16 antibody was raised against the middle region of CEACAM16

Purification: Affinity purified

Immunogen: CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CEACAM16 Blocking Peptide, (ABIN5612810), is also available for use as a blocking control in assays to test for specificity of this CEACAM16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CEACAM16

Target: CEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16 (CEACAM16))

Alternative Name: CEACAM16

Background: CEACAM16 is a single-pass type I membrane protein.It belongs to the immunoglobulin superfamily, CEA family.It contains 2 Ig-like C2-type (immunoglobulin-like) domains. The exact function of CEACAM16 remains unknown.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Sensory Perception of Sound