HSD3B2 antibody (N-Term)

Catalog No. ABIN635014

This Rabbit Polyclonal antibody specifically detects HSD3B2 in WB. It exhibits reactivity toward Human.

Quick Overview for HSD3B2 antibody (N-Term) (ABIN635014)

Target: HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD3B2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSD3B2 Antibody

Binding Specificity: N-Term

Specificity: HSD3 B2 antibody was raised against the N terminal of HSD3 2

Purification: Affinity purified

Immunogen: HSD3 B2 antibody was raised using the N terminal of HSD3 2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD3B2 Blocking Peptide, (ABIN939057), is also available for use as a blocking control in assays to test for specificity of this HSD3B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD3B2

Target: HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))

Alternative Name: HSD3B2

Background: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis