TMEM30B antibody (Middle Region)

Catalog No. ABIN635017

Product Details anti-TMEM30B Antibody

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM30B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM30 B antibody was raised against the middle region of TMEM30

Purification: Affinity purified

Immunogen: TMEM30 B antibody was raised using the middle region of TMEM30 corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM30B Blocking Peptide, catalog no. 33R-9922, is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM30B

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Alternative Name: TMEM30B (TMEM30B Products)

Synonyms: CDC50B antibody, 9130011B11Rik antibody, transmembrane protein 30B antibody, TMEM30B antibody, Tmem30b antibody

Background: TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.

Molecular Weight: 39 kDa (MW of target protein)