NCAM2 antibody (Middle Region)

Catalog No. ABIN635019

Product Details anti-NCAM2 Antibody

Target: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NCAM2 antibody was raised against the middle region of NCAM2

Purification: Affinity purified

Immunogen: NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAM2

Target: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Alternative Name: NCAM2 (NCAM2 Products)

Synonyms: NCAM21 antibody, Ncam-2 antibody, Ocam antibody, RNCAM antibody, zOCAM antibody, OCAM-GPI antibody, NCAM2 antibody, ncam21 antibody, neural cell adhesion molecule 2 antibody, zgc:152904 antibody, NCAM2 antibody, Ncam2 antibody, ncam2 antibody, LOC100471034 antibody, zgc:152904 antibody

Background: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Molecular Weight: 91 kDa (MW of target protein)