ROBO2 antibody

Catalog No. ABIN635030

The Rabbit Polyclonal anti-ROBO2 antibody has been validated for WB. It is suitable to detect ROBO2 in samples from Human, Mouse and Rat.

Quick Overview for ROBO2 antibody (ABIN635030)

Target: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ROBO2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ROBO2 Antibody

Purification: Affinity purified

Immunogen: ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ROBO2 Blocking Peptide, (ABIN5615914), is also available for use as a blocking control in assays to test for specificity of this ROBO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROBO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ROBO2

Target: ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))

Alternative Name: ROBO2

Background: ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.

Molecular Weight: 151 kDa (MW of target protein)

Pathways: Regulation of Cell Size