SLC25A38 antibody (Middle Region)

Catalog No. ABIN635042

The Rabbit Polyclonal anti-SLC25A38 antibody has been validated for WB and IHC. It is suitable to detect SLC25A38 in samples from Human, Mouse, Rat and Dog.

Quick Overview for SLC25A38 antibody (Middle Region) (ABIN635042)

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A38 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC25A38 Antibody

Binding Specificity: Middle Region

Specificity: SLC25 A38 antibody was raised against the middle region of SLC25 38

Purification: Affinity purified

Immunogen: SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A38 Blocking Peptide, (ABIN5616224), is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A38

Target: SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))

Alternative Name: SLC25A38

Background: SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Molecular Weight: 33 kDa (MW of target protein)