SLC25A32 antibody (Middle Region)

Catalog No. ABIN635047

This Rabbit Polyclonal antibody specifically detects SLC25A32 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SLC25A32 antibody (Middle Region) (ABIN635047)

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A32 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A32 Antibody

Binding Specificity: Middle Region

Specificity: SLC25 A32 antibody was raised against the middle region of SLC25 32

Purification: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A32 Blocking Peptide, (ABIN5616220), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Alternative Name: SLC25A32

Background: SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport