Monoamine Oxidase B antibody (C-Term)

Catalog No. ABIN635051

Product Details anti-Monoamine Oxidase B Antibody

Target: Monoamine Oxidase B (MAOB)

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Monoamine Oxidase B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAOB antibody was raised against the C terminal of MAOB

Purification: Affinity purified

Immunogen: MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAOB Blocking Peptide, catalog no. 33R-3365, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Monoamine Oxidase B

Target: Monoamine Oxidase B (MAOB)

Alternative Name: MAOB (MAOB Products)

Background: MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Molecular Weight: 59 kDa (MW of target protein)