Monoamine Oxidase B antibody (C-Term)
-
- Target See all Monoamine Oxidase B (MAOB) Antibodies
- Monoamine Oxidase B (MAOB)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Monoamine Oxidase B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAOB antibody was raised against the C terminal of MAOB
- Purification
- Affinity purified
- Immunogen
- MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
- Top Product
- Discover our top product MAOB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAOB Blocking Peptide, catalog no. 33R-3365, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Monoamine Oxidase B (MAOB)
- Alternative Name
- MAOB (MAOB Products)
- Synonyms
- MAOB antibody, Z-MAO antibody, maob antibody, moa antibody, wu:fb68b05 antibody, wu:fo76d11 antibody, wu:fq38g06 antibody, zgc:85761 antibody, MAOA antibody, 6330414K01Rik antibody, MAO-B antibody, monoamine oxidase B antibody, amine oxidase [flavin-containing] B antibody, monoamine oxidase antibody, monoamine oxidase B L homeolog antibody, MAOB antibody, Gbro_4276 antibody, LOC100223232 antibody, mao antibody, Maob antibody, maob.L antibody
- Background
- MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.
- Molecular Weight
- 59 kDa (MW of target protein)
-