CXorf66 antibody (Chromosome X Open Reading Frame 66) (Middle Region)

Details for Product anti-CXorf66 Antibody No. ABIN635057
Target
Binding Specificity
Middle Region
1
1
Reactivity
Human
2
Host
Rabbit
2
Clonality
Polyclonal
Application
Western Blotting (WB)
2
Options
Immunogen CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE
Specificity CXorf66 antibody was raised against the middle region of CXorf66
Purification Affinity purified
Target
Alternative Name CXorf66 (CXorf66 Antibody Abstract)
Background The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.
Molecular Weight 40 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Chromosome X Open Reading Frame 66 (CXorf66) (Middle Region) antibody (ABIN635057) CXorf66 antibody used at 1 ug/ml to detect target protein.