Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CXorf66 antibody (Chromosome X Open Reading Frame 66) (Middle Region) Primary Antibody

CXorf66 Reactivity: Human WB Host: Rabbit Polyclonal
Catalog No. ABIN635057
$517.86
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Binding Specificity
    Middle Region
    Reactivity
    Human
    Host
    Rabbit
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    Specificity
    CXorf66 antibody was raised against the middle region of CXorf66
    Purification
    Affinity purified
    Immunogen
    CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    CXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Alternative Name
    CXorf66 (CXorf66 Antibody Abstract)
    Background
    The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.
    Molecular Weight
    40 kDa (MW of target protein)
You are here: