SLC25A32 antibody (N-Term)

Catalog No. ABIN635067

This anti-SLC25A32 antibody is a Rabbit Polyclonal antibody detecting SLC25A32 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for SLC25A32 antibody (N-Term) (ABIN635067)

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A32 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A32 Antibody

Binding Specificity: N-Term

Specificity: SLC25 A32 antibody was raised against the N terminal of SLC25 32

Purification: Affinity purified

Immunogen: SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A32 Blocking Peptide, (ABIN5616221), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A32

Target: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Alternative Name: SLC25A32

Background: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport