LINGO4 antibody (Middle Region)

Catalog No. ABIN635071

Product Details anti-LINGO4 Antibody

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LINGO4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LINGO4 antibody was raised against the middle region of LINGO4

Purification: Affinity purified

Immunogen: LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LINGO4 Blocking Peptide, catalog no. 33R-9169, is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LINGO4

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Alternative Name: LINGO4 (LINGO4 Products)

Synonyms: A530050P17Rik antibody, LERN4 antibody, Lrrn6d antibody, RGD1562025 antibody, DAAT9248 antibody, LRRN6D antibody, PRO34002 antibody, zgc:198379 antibody, leucine rich repeat and Ig domain containing 4 antibody, leucine rich repeat and Ig domain containing 4b antibody, Lingo4 antibody, LINGO4 antibody, lingo4b antibody

Background: The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 64 kDa (MW of target protein)