DPP10 antibody (Middle Region)

Catalog No. ABIN635073

This anti-DPP10 antibody is a Rabbit Polyclonal antibody detecting DPP10 in WB. Suitable for Human.

Quick Overview for DPP10 antibody (Middle Region) (ABIN635073)

Target: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPP10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPP10 Antibody

Binding Specificity: Middle Region

Specificity: DPP10 antibody was raised against the middle region of DPP10

Purification: Affinity purified

Immunogen: DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPP10 Blocking Peptide, (ABIN5613247), is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPP10

Target: DPP10 (Dipeptidylpeptidase 10 (DPP10))

Alternative Name: DPP10

Background: DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.

Molecular Weight: 90 kDa (MW of target protein)