DHODH antibody (N-Term)

Catalog No. ABIN635074

Product Details anti-DHODH Antibody

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHODH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DHODH antibody was raised against the N terminal of DHODH

Purification: Affinity purified

Immunogen: DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHODH Blocking Peptide, catalog no. 33R-7911, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Alternative Name: DHODH (DHODH Products)

Background: DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus