DHODH antibody (C-Term)
-
- Target See all DHODH Antibodies
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHODH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DHODH antibody was raised against the C terminal of DHODH
- Purification
- Affinity purified
- Immunogen
- DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
- Top Product
- Discover our top product DHODH Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHODH Blocking Peptide, catalog no. 33R-3293, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Alternative Name
- DHODH (DHODH Products)
- Background
- DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-