SLC25A39 antibody (C-Term)

Catalog No. ABIN635082

The Rabbit Polyclonal anti-SLC25A39 antibody (ABIN635082) specifically detects SLC25A39 in WB and IHC. The antibody is reactive with Mouse, Human, Dog and Rat samples.

Quick Overview for SLC25A39 antibody (C-Term) (ABIN635082)

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A39 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC25A39 Antibody

Binding Specificity: C-Term

Specificity: SLC25 A39 antibody was raised against the C terminal of SLC25 39

Purification: Affinity purified

Immunogen: SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A39 Blocking Peptide, (ABIN5616225), is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A39

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Alternative Name: SLC25A39

Background: SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Molecular Weight: 39 kDa (MW of target protein)