SLC25A22 antibody

Catalog No. ABIN635084

The Rabbit Polyclonal anti-SLC25A22 antibody has been validated for WB. It is suitable to detect SLC25A22 in samples from Human.

Quick Overview for SLC25A22 antibody (ABIN635084)

Target: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A22 Antibody

Purification: Affinity purified

Immunogen: SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A22 Blocking Peptide, (ABIN5616215), is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A22

Target: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Alternative Name: SLC25A22

Background: The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport