SLC25A35 antibody (N-Term)

Catalog No. ABIN635087

Product Details anti-SLC25A35 Antibody

Target: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A35 antibody was raised against the N terminal of SLC25 35

Purification: Affinity purified

Immunogen: SLC25 A35 antibody was raised using the N terminal of SLC25 35 corresponding to a region with amino acids DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A35 Blocking Peptide, catalog no. 33R-1931, is also available for use as a blocking control in assays to test for specificity of this SLC25A35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A35

Target: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Alternative Name: SLC25A35 (SLC25A35 Products)

Synonyms: si:ch211-268m12.5 antibody, 1810012H11Rik antibody, solute carrier family 25, member 35 antibody, solute carrier family 25 member 35 antibody, slc25a35 antibody, SLC25A35 antibody, Slc25a35 antibody

Background: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Molecular Weight: 31 kDa (MW of target protein)