MFSD1 antibody (Middle Region)

Catalog No. ABIN635106

The Rabbit Polyclonal anti-MFSD1 antibody (ABIN635106) specifically detects MFSD1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for MFSD1 antibody (Middle Region) (ABIN635106)

Target: MFSD1 (Major Facilitator Superfamily Domain Containing 1 (MFSD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFSD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MFSD1 Antibody

Binding Specificity: Middle Region

Specificity: MFSD1 antibody was raised against the middle region of MFSD1

Purification: Affinity purified

Immunogen: MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFSD1 Blocking Peptide, (ABIN5614741), is also available for use as a blocking control in assays to test for specificity of this MFSD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFSD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFSD1

Target: MFSD1 (Major Facilitator Superfamily Domain Containing 1 (MFSD1))

Alternative Name: MFSD1

Background: The function of MFSD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)