SLC15A2 antibody

Catalog No. ABIN635108

The Rabbit Polyclonal anti-SLC15A2 antibody is suitable to detect SLC15A2 in samples from Human. It has been validated for WB.

Quick Overview for SLC15A2 antibody (ABIN635108)

Target: SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC15A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC15A2 Antibody

Purification: Affinity purified

Immunogen: SLC15 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC15A2 Blocking Peptide, (ABIN938831), is also available for use as a blocking control in assays to test for specificity of this SLC15A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC15A2

Target: SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))

Alternative Name: SLC15A2

Background: SLC15A2 belongs to the PTR2/POT transporter family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.

Molecular Weight: 82 kDa (MW of target protein)